Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP49612_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP49612_P050-FITC Conjugated

ARP49612_P050-HRP Conjugated

ARP49612_P050-Biotin Conjugated

NMB Antibody - N-terminal region (ARP49612_P050)

Catalog#: ARP49612_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Human, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Guinea Pig: 86%; Human: 100%; Rabbit: 79%
Complete computational species homology dataAnti-NMB (ARP49612_P050)
Peptide SequenceSynthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-NMB (ARP49612_P050) antibody is Catalog # AAP49612
Datasheets/ManualsPrintable datasheet for anti-NMB (ARP49612_P050) antibody
Gene SymbolNMB
Official Gene Full Nameneuromedin B
Alias SymbolsNMB,
NCBI Gene Id4828
Protein NameNeuromedin-B
Description of TargetNMB stimulates smooth muscle contraction in a manner similar to that of bombesin.
Swissprot IdP08949
Protein Size (# AA)121
Molecular Weight13kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express NMB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express NMB.
Protein InteractionsBIRC2; Dlg4; TPP1; NMBR;
Write Your Own Review
You're reviewing:NMB Antibody - N-terminal region (ARP49612_P050)
Your Rating
Aviva Tips and Tricks
Aviva Travel Grant
Aviva Blast Tool
Aviva HIS tag Deal