Search Antibody, Protein, and ELISA Kit Solutions

NMB Antibody - N-terminal region (ARP49612_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP49612_P050-FITC Conjugated

ARP49612_P050-HRP Conjugated

ARP49612_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NMB
Official Gene Full Name:
neuromedin B
NCBI Gene Id:
4828
Protein Name:
Neuromedin-B
Swissprot Id:
P08949
Alias Symbols:
NMB,
Description of Target:
NMB stimulates smooth muscle contraction in a manner similar to that of bombesin.
Protein Size (# AA):
121
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NMB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NMB.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB
Predicted Species Reactivity:
Cow, Guinea Pig, Human, Rabbit
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Guinea Pig: 86%; Human: 100%; Rabbit: 79%
Complete computational species homology data:
Anti-NMB (ARP49612_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BIRC2; Dlg4; TPP1; NMBR;
Blocking Peptide:
For anti-NMB (ARP49612_P050) antibody is Catalog # AAP49612
Datasheets/Manuals:
Printable datasheet for anti-NMB (ARP49612_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...