Search Antibody, Protein, and ELISA Kit Solutions

NLRC4 Antibody - C-terminal region (AVARP00019_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

AVARP00019_P050-FITC Conjugated

AVARP00019_P050-HRP Conjugated

AVARP00019_P050-Biotin Conjugated

Gene Symbol:
NLRC4
Official Gene Full Name:
NLR family, CARD domain containing 4
NCBI Gene Id:
58484
Protein Name:
NLR family CARD domain-containing protein 4
Swissprot Id:
Q9NPP4
Protein Accession #:
NP_067032
Nucleotide Accession #:
NM_021209
Alias Symbols:
CLAN, IPAF, CLAN1, CLANA, CLANB, CLANC, CLAND, CARD12, CLR2.1
Replacement Item:
This antibody may replace item sc-49394 from Santa Cruz Biotechnology.
Description of Target:
In C. elegans, Ced4 binds and activates Ced3, an apoptotic initiator caspase, via caspase-associated recruitment domains (CARDs). Human Ced4 homologs include APAF1, NOD1, and NOD2. These proteins have at least 1 N-terminal CARD domain followed by a centrally located nucleotide-binding domain (NBD or NACHT) and a C-terminal regulatory domain, found only in mammals, that contains either WD40 repeats or leucine-rich repeats (LRRs). CARD12 is a member of the Ced4 family and can induce apoptosis.
Protein Size (# AA):
1024
Molecular Weight:
116kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NLRC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NLRC4.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NLRC4
Predicted Species Reactivity:
Guinea Pig, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Guinea Pig: 80%; Human: 100%; Mouse: 86%; Rat: 80%
Complete computational species homology data:
Anti-NLRC4 (AVARP00019_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; XK; ALB; NLRC4; PSMC5; CASP8; NLRP4; PYCARD; NOD2; BCL10; CASP1; NLRP1; NLRP3; NOD1; NAIP;
Blocking Peptide:
For anti-NLRC4 (AVARP00019_P050) antibody is Catalog # AAP30490 (Previous Catalog # AAPP01126)
Datasheets/Manuals:
Printable datasheet for anti-NLRC4 (AVARP00019_P050) antibody
Specificity:
This antibody will recognize NLRC4 isoform 1 (116kD) and isoform 2 (40kD).
Target Reference:
Clark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Publications:

Inflammasomes are important mediators of cyclophosphamide-induced bladder inflammation. Am J Physiol Renal Physiol. 306, F299-308 (2014). IHC, WB, Guinea Pig, Human, Mouse, Rat 24285499

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...