Catalog No: AVARP00019_P050
Price: $0.00
SKU
AVARP00019_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NLRC4 (AVARP00019_P050) antibody
Product Info
Publications

Inflammasomes are important mediators of cyclophosphamide-induced bladder inflammation. Am J Physiol Renal Physiol. 306, F299-308 (2014). 24285499

The potential repertoire of the innate immune system in the bladder: expression of pattern recognition receptors in the rat bladder and a rat urothelial cell line (MYP3 cells). Int Urol Nephrol. 47, 1953-64 (2015). 26490556

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NLRC4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 80%; Human: 100%; Mouse: 86%; Rat: 80%
Peptide SequenceSynthetic peptide located within the following region: QLNLAGNRVSSDGWLAFMGVFENLKQLVFFDFSTKEFLPDPALVRKLSQV
Concentration0.5 mg/ml
Blocking PeptideFor anti-NLRC4 (AVARP00019_P050) antibody is Catalog # AAP30490 (Previous Catalog # AAPP01126)
SpecificityThis antibody will recognize NLRC4 isoform 1 (116kD) and isoform 2 (40kD).
ReferenceClark,H.F., et al., (2003) Genome Res. 13 (10), 2265-2270
Gene SymbolNLRC4
Gene Full NameNLR family, CARD domain containing 4
Alias SymbolsCLAN, IPAF, AIFEC, CLAN1, CLANA, CLANB, CLANC, CLAND, FCAS4, CARD12, CLR2.1
NCBI Gene Id58484
Protein NameNLR family CARD domain-containing protein 4
Description of TargetIn C. elegans, Ced4 binds and activates Ced3, an apoptotic initiator caspase, via caspase-associated recruitment domains (CARDs). Human Ced4 homologs include APAF1, NOD1, and NOD2. These proteins have at least 1 N-terminal CARD domain followed by a centrally located nucleotide-binding domain (NBD or NACHT) and a C-terminal regulatory domain, found only in mammals, that contains either WD40 repeats or leucine-rich repeats (LRRs). CARD12 is a member of the Ced4 family and can induce apoptosis.
Uniprot IDQ9NPP4
Protein Accession #NP_067032
Nucleotide Accession #NM_021209
Protein Size (# AA)1024
Molecular Weight116kDa
Protein InteractionsUBC; XK; ALB; NLRC4; PSMC5; CASP8; NLRP4; PYCARD; NOD2; BCL10; CASP1; NLRP1; NLRP3; NOD1; NAIP;
  1. What is the species homology for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig".

  2. How long will it take to receive "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NLRC4 Antibody - C-terminal region (AVARP00019_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    This target may also be called "CLAN, IPAF, AIFEC, CLAN1, CLANA, CLANB, CLANC, CLAND, FCAS4, CARD12, CLR2.1" in publications.

  5. What is the shipping cost for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "116kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NLRC4 Antibody - C-terminal region (AVARP00019_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NLRC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NLRC4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NLRC4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NLRC4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NLRC4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NLRC4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NLRC4 Antibody - C-terminal region (AVARP00019_P050)
Your Rating
We found other products you might like!