ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP56863_P050
Price: $0.00
SKU
ARP56863_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NLK (ARP56863_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NLK
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: RLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
Concentration0.5 mg/ml
Blocking PeptideFor anti-NLK (ARP56863_P050) antibody is Catalog # AAP56863 (Previous Catalog # AAPP44229)
Gene SymbolNLK
Gene Full NameNemo-like kinase
Alias SymbolsDKFZp761G1211, FLJ21033
NCBI Gene Id51701
Protein NameSerine/threonine-protein kinase NLK
Description of TargetNLK has a role in cell fate determination, required for differentiation of bone marrow stromal cells. NLK acts downstream of MAP3K7 and HIPK2 to negatively regulate the canonical Wnt/beta-catenin signaling pathway and the phosphorylation and destruction of the MYB transcription factor. NLK may suppress a wide range of transcription factors by phosphorylation of the coactivator, CREBBP By similarity.NLK is involved in TGFbeta-mediated mesoderm induction, acting downstream of MAP3K7/TAK1 to phosphorylate STAT3.
Uniprot IDQ9UBE8
Protein Accession #NP_057315
Nucleotide Accession #NM_016231
Protein Size (# AA)527
Molecular Weight58kDa
Protein InteractionsKRTAP5-6; KRTAP10-3; KRTAP4-2; QRICH1; ZHX3; KRTAP5-9; GRN; TP53; MDM2; STAT5A; LEF1; CNOT2; SMAD4; KPNB1; BACH1; TNKS1BP1; FAM222A; C2orf44; CEP97; RNF219; FAM222B; CNOT11; NLK; PASK; SHANK2; UBAP2L; CCP110; TRPS1; TLE3; SKI; RANGAP1; RANBP2; PKM; CNOT3;
  1. What is the species homology for "NLK Antibody - middle region (ARP56863_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "NLK Antibody - middle region (ARP56863_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NLK Antibody - middle region (ARP56863_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NLK Antibody - middle region (ARP56863_P050)"?

    This target may also be called "DKFZp761G1211, FLJ21033" in publications.

  5. What is the shipping cost for "NLK Antibody - middle region (ARP56863_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NLK Antibody - middle region (ARP56863_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NLK Antibody - middle region (ARP56863_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NLK Antibody - middle region (ARP56863_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NLK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NLK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NLK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NLK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NLK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NLK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NLK Antibody - middle region (ARP56863_P050)
Your Rating
We found other products you might like!