NKX6-1 Antibody - N-terminal region (ARP32720_P050)

Catalog No: ARP32720_P050

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

WB Suggested Anti-NKX6-1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Host: Mouse
Target Name: NKX6-1
Sample Tissue: Mouse Liver
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKX6-1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NKX6-1 (ARP32720_P050) antibody is Catalog # AAP32720 (Previous Catalog # AAPP03734)
• Reference: Schisler,J.C., (2008) Mol. Cell. Biol. 28 (10), 3465-3476

Target Info

• Gene Symbol: NKX6-1
• Gene Full Name: NK6 homeobox 1
• Alias Symbols: NKX6A, NKX6.1
• NCBI Gene Id: 4825
• Protein Name: Homeobox protein Nkx-6.1
• Description of Target: NKX6-1 is the transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-300 U66797.1 1-300 301-307 AC096766.3 119394-119400 c 308-676 U66797.1 308-676 677-849 U66798.1 7-179 850-1116 U66799.1 7-273
• Uniprot ID: P78426
• Protein Accession #: NP_006159
• Nucleotide Accession #: NM_006168
• Protein Size (# AA): 367
• Molecular Weight: 38 kDa