ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP58064_P050
Price: $0.00
SKU
ARP58064_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NKX3-2 (ARP58064_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NKX3-2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%
Peptide SequenceSynthetic peptide located within the following region: GAGGGGGSGPAGVAEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQR
Concentration0.5 mg/ml
Blocking PeptideFor anti-NKX3-2 (ARP58064_P050) antibody is Catalog # AAP58064 (Previous Catalog # AAPP32487)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceRodrigo,I., (2004) Mol. Cell. Biol. 24 (7), 2757-2766
Publications

Kamel, G. et al. Requirement for frzb and fzd7a in cranial neural crest convergence and extension mechanisms during zebrafish palate and jaw morphogenesis. Dev. Biol. 381, 423-33 (2013). 23806211

Gene SymbolNKX3-2
Gene Full NameNK3 homeobox 2
Alias SymbolsSMMD, BAPX1, NKX3B, NKX3.2
NCBI Gene Id579
Protein NameHomeobox protein Nkx-3.2
Description of TargetNKX3-2 is a member of the NK family of homeobox-containing proteins. It may play a role in skeletal development.This gene encodes a member of the NK family of homeobox-containing proteins. The encoded protein may play a role in skeletal development. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1111 BC111966.1 1-1111 1112-2241 AC006445.11 110916-112045
Uniprot IDP78367
Protein Accession #NP_001180
Nucleotide Accession #NM_001189
Protein Size (# AA)333
Molecular Weight35 kDa
Protein InteractionsSIN3A; RBBP7; RBBP4; SMAD4; SMAD1; HDAC1;
  1. What is the species homology for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast".

  2. How long will it take to receive "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NKX3-2 Antibody - middle region (ARP58064_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    This target may also be called "SMMD, BAPX1, NKX3B, NKX3.2" in publications.

  5. What is the shipping cost for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NKX3-2 Antibody - middle region (ARP58064_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NKX3-2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NKX3-2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NKX3-2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NKX3-2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NKX3-2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NKX3-2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NKX3-2 Antibody - middle region (ARP58064_P050)
Your Rating
We found other products you might like!