Nkx2-5 Antibody - N-terminal region (ARP31575_P050)

Catalog No: ARP31575_P050

WB Suggested Anti-Nkx2-5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Host: Mouse
Target Name: NKX2-5
Sample Tissue: Mouse Heart
Antibody Dilution: 1ug/ml

Rabbit Anti-NKX2-5 Antibody
Catalog Number: ARP31575_P050
Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue
Observed Staining: Nucleus
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human Nkx2-5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 85%; Guinea Pig: 92%; Horse: 77%; Human: 100%; Mouse: 92%; Rabbit: 77%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: ELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Nkx2-5 (ARP31575_P050) antibody is Catalog # AAP31575 (Previous Catalog # AAPP02354)
• Reference: Nagel,S., (2008) Leukemia 22 (3), 600-607

Target Info

• Gene Symbol: Nkx2-5
• Gene Full Name: NK2 homeobox 5
• Alias Symbols: CSX, CSX1, VSD3, CHNG5, HLHS2, NKX2E, NKX2.5, NKX4-1
• NCBI Gene Id: 1482
• Protein Name: Homeobox protein Nkx-2.5
• Description of Target: Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development. It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development (Shiojima et al., 1995 [PubMed 7665173]). It has been demonstrated that a Drosophila homeobox-containing gene called 'tinman' is expressed in the developing dorsal vessel and in the equivalent of the vertebrate heart. Mutations in tinman result in loss of heart formation in the embryo, suggesting that tinman is essential for Drosophila heart formation. Furthermore, abundant expression of Csx, the presumptive mouse homolog of tinman, is observed only in the heart from the time of cardiac differentiation. CSX, the human homolog of murine Csx, has a homeodomain sequence identical to that of Csx and is expressed only in the heart, again suggesting that CSX plays an important role in human heart formation.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1211 U34962.1 1-1211 1212-1585 BC025711.1 1143-1516
• Uniprot ID: P52952
• Protein Accession #: NP_004378
• Nucleotide Accession #: NM_004387
• Protein Size (# AA): 324
• Molecular Weight: 35kDa
• Protein Interactions: JARID2; GATA4; KDM6A; SMAD4; CAMTA2; TLE1; HDAC1; ID3; ID2; ID1; HIPK1; HIPK2; FOXH1; TBX5; TBX2; SRF; CSNK2A1;