Search Antibody, Protein, and ELISA Kit Solutions

NKX2-2 Antibody - N-terminal region (ARP38167_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38167_P050-FITC Conjugated

ARP38167_P050-HRP Conjugated

ARP38167_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NKX2-2
Official Gene Full Name:
NK2 homeobox 2
NCBI Gene Id:
4821
Protein Name:
Homeobox protein Nkx-2.2
Swissprot Id:
O95096
Protein Accession #:
NP_002500
Nucleotide Accession #:
NM_002509
Alias Symbols:
NKX2.2, NKX2B
Replacement Item:
This antibody may replace item sc-133825 from Santa Cruz Biotechnology.
Description of Target:
Nkx2-2 contains 1 homeobox DNA-binding domain which is essential for interaction with OLIG2. Nkx2-2 may be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.
Protein Size (# AA):
273
Molecular Weight:
30kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NKX2-2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NKX2-2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NKX2-2
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-NKX2-2 (ARP38167_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Dlg4; SIN3A; HDAC1; OLIG2;
Blocking Peptide:
For anti-NKX2-2 (ARP38167_P050) antibody is Catalog # AAP38167 (Previous Catalog # AAPP20343)
Datasheets/Manuals:
Printable datasheet for anti-NKX2-2 (ARP38167_P050) antibody
Target Reference:
Owen,L.A., (er) PLoS ONE 3 (4), E1965 (2008)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...