Catalog No: ARP55370_P050
Price: $0.00
SKU
ARP55370_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NKIRAS1 (ARP55370_P050) antibody
Product Info
ReferenceAdams,M.D., (er) Ann. Rheum. Dis. (2008) In press
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
Concentration0.5 mg/ml
Blocking PeptideFor anti-NKIRAS1 (ARP55370_P050) antibody is Catalog # AAP55370 (Previous Catalog # AAPP33242)
Gene SymbolNKIRAS1
Gene Full NameNFKB inhibitor interacting Ras-like 1
Alias SymbolsKBRAS1, kappaB-Ras1
NCBI Gene Id28512
Protein NameNF-kappa-B inhibitor-interacting Ras-like protein 1
Description of TargetNKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
Uniprot IDQ9NYS0
Protein Accession #NP_065078
Nucleotide Accession #NM_020345
Protein Size (# AA)192
Molecular Weight22kDa
Protein InteractionsXRCC2; UBC; APP; NFKBIB; SMURF2; BMPR1B; TGFBR1; NFKBIA; ACVR1;
  1. What is the species homology for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    This target may also be called "KBRAS1, kappaB-Ras1" in publications.

  5. What is the shipping cost for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NKIRAS1 Antibody - N-terminal region (ARP55370_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NKIRAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NKIRAS1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NKIRAS1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NKIRAS1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NKIRAS1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NKIRAS1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NKIRAS1 Antibody - N-terminal region (ARP55370_P050)
Your Rating