Search Antibody, Protein, and ELISA Kit Solutions

NKD1 Antibody - middle region (ARP41286_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41286_P050-FITC Conjugated

ARP41286_P050-HRP Conjugated

ARP41286_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NKD1
Official Gene Full Name:
Naked cuticle homolog 1 (Drosophila)
NCBI Gene Id:
85407
Protein Name:
Protein naked cuticle homolog 1
Swissprot Id:
Q969G9
Protein Accession #:
NP_149110
Nucleotide Accession #:
NM_033119
Alias Symbols:
Naked1
Replacement Item:
This antibody may replace item sc-102039 from Santa Cruz Biotechnology.
Description of Target:
In the mouse, Nkd is a Dishevelled -binding protein that functions as a negative regulator of the Wnt-beta-catenin -Tcf signaling pathway.
Protein Size (# AA):
470
Molecular Weight:
52kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NKD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NKD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NKD1
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-NKD1 (ARP41286_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DVL3;
Blocking Peptide:
For anti-NKD1 (ARP41286_P050) antibody is Catalog # AAP41286 (Previous Catalog # AAPY01306)
Datasheets/Manuals:
Printable datasheet for anti-NKD1 (ARP41286_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...