NIP7 Antibody - C-terminal region (ARP40833_T100)

Catalog No: ARP40833_T100

WB Suggested Anti-NIP7 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateNIP7 is supported by BioGPS gene expression data to be expressed in HepG2

Rabbit Anti-NIP7 Antibody
Catalog Number: ARP40833
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NIP7
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%; Yeast: 79%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NIP7 (ARP40833_T100) antibody is Catalog # AAP40833 (Previous Catalog # AAPY01085)
• Sample Type Confirmation:

  NIP7 is supported by BioGPS gene expression data to be expressed in HepG2

• Subunit: biogenesis protein NIP7 homolog
• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954
• Publications:

  Zinzalla, V., Stracka, D., Oppliger, W. & Hall, M. N. Activation of mTORC2 by association with the ribosome. Cell 144, 757-68 (2011). 21376236

Target Info

• Gene Symbol: NIP7
• Gene Full Name: Nuclear import 7 homolog (S. cerevisiae)
• Alias Symbols: KD93, CGI-37, HSPC031
• NCBI Gene Id: 51388
• Protein Name: 60S ribosome subunit biogenesis protein NIP7 homolog
• Description of Target: NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
• Uniprot ID: Q9Y221
• Protein Accession #: NP_057185
• Nucleotide Accession #: NM_016101
• Protein Size (# AA): 180
• Molecular Weight: 20kDa
• Protein Interactions: LZTS2; NECAB2; NIP7; CRX; SOX2; UBC; ELAVL1; NOL8; ZBED1;