NGLY1 Antibody - middle region (ARP75684_P050)

Catalog No: ARP75684_P050

Host: Rabbit
Target Name: NGLY1
Sample Type: 786-0 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NGLY1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: DRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGRCG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NGLY1 (ARP75684_P050) antibody is Catalog # AAP75684
• Reference: N/A

Target Info

• Gene Symbol: NGLY1
• Alias Symbols: CDDG, PNG1, CDG1V, PNG-1, PNGase
• NCBI Gene Id: 55768
• Description of Target: This gene encodes an enzyme that catalyzes hydrolysis of an N(4)-(acetyl-beta-D-glucosaminyl) asparagine residue to N-acetyl-beta-D-glucosaminylamine and a peptide containing an aspartate residue. The encoded enzyme may play a role in the proteasome-mediated degradation of misfolded glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q96IV0-3
• Protein Size (# AA): 558
• Molecular Weight: 61kDa
• Protein Interactions: UBXN2B; GUCD1; TRIM54; UBQLN1; TRAFD1; UBC; RAD23B; RAD23A; FBXO6; SRPK2; env; APP; DERL1; NSFL1C; FAF1; VCP;