Search Antibody, Protein, and ELISA Kit Solutions

NGFR Antibody - C-terminal region : Biotin (ARP63279_P050-Biotin)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63279_P050 Unconjugated

ARP63279_P050-FITC Conjugated

ARP63279_P050-HRP Conjugated

Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Gene Symbol:
Official Gene Full Name:
Nerve growth factor receptor
NCBI Gene Id:
Protein Name:
Tumor necrosis factor receptor superfamily member 16
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD271, Gp80-LNGFR, TNFRSF16, p75(NTR), p75NTR
Replacement Item:
This antibody may replace item sc-13577 from Santa Cruz Biotechnology.
Description of Target:
Nerve growth factor receptor contains an extracellular domain containing four 40-amino acid repeats with 6 cysteine residues at conserved positions followed by a serine/threonine-rich region, a single transmembrane domain, and a 155-amino acid cytoplasmic domain. The cysteine-rich region contains the nerve growth factor binding domain.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NGFR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NGFR.
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-NGFR (ARP63279_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NGFR (ARP63279_P050-Biotin) antibody is Catalog # AAP63279
Printable datasheet for anti-NGFR (ARP63279_P050-Biotin) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...