Loading...
Catalog No: P100680_P050
Price: $0.00
SKU
P100680_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFX1 (P100680_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NFX1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 85%; Human: 100%; Mouse: 76%; Rabbit: 85%; Rat: 85%
Peptide SequenceSynthetic peptide located within the following region: TLTGVLEREMQARPPPPIPHHRHQSDKNPGSSNLQKITKEPIIDYFDVQD
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFX1 (P100680_P050) antibody is Catalog # AAP31019 (Previous Catalog # AAPP01752)
ReferenceKatzenellenbogen,R.A., (2007) J. Virol. 81 (8), 3786-3796
Description
Gene SymbolNFX1
Gene Full NameNuclear transcription factor, X-box binding 1
Alias SymbolsNFX2, Tex42, TEG-42
NCBI Gene Id4799
Protein NameTranscriptional repressor NF-X1
Description of TargetMHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. NFX1 is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma.MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified.
Uniprot IDQ12986
Protein Accession #NP_002495
Nucleotide Accession #NM_002504
Protein Size (# AA)1120
Molecular Weight124kDa
Protein InteractionsUBC; BMI1; HECW2; SRSF4; SRSF3; RPS19; RPS3A; RPL22; RPL17; RPL13; RPL7A; RPL6; RPL3; PABPC3; YBX1; NCL; HNRNPM; HSPA1A; HNRNPU; HNRNPH1; HNRNPA2B1; HIST1H2AE; EEF1A2; DMD; DDX5; FAM208B; PABPC1; RPL13A; LARP1; APC2; MATR3; HIST1H4E; USP9X; SIN3A; MAML3;
  1. What is the species homology for "NFX1 Antibody - middle region (P100680_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Rabbit".

  2. How long will it take to receive "NFX1 Antibody - middle region (P100680_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFX1 Antibody - middle region (P100680_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFX1 Antibody - middle region (P100680_P050)"?

    This target may also be called "NFX2, Tex42, TEG-42" in publications.

  5. What is the shipping cost for "NFX1 Antibody - middle region (P100680_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFX1 Antibody - middle region (P100680_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFX1 Antibody - middle region (P100680_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "124kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFX1 Antibody - middle region (P100680_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFX1 Antibody - middle region (P100680_P050)
Your Rating