NFUA Recombinant Protein (Vibrio vulnificus) (OPCA05259)

Catalog No: OPCA05259

Product Info

• Predicted Species Reactivity: Vibrio vulnificus
• Product Format: Liquid
• Additional Information: Species Specificity Detail: Vibrio vulnificus (strain CMCP6)
• Reconstitution and Storage: Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
• Storage Buffer: Tris-base, 50% glycerol
• Source: E.coli
• Tag: NO-tagged
• Reference: Complete genome sequence of Vibrio vulnificus CMCP6.
  Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.
  Submitted (DEC-2002)

Target Info

• Gene Symbol: NFUA
• NCBI Gene Id: 2622994
• Protein Name: Fe/S biogenesis protein NfuA
• Description of Target: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.UniRule annotation.
• Uniprot ID: Q8DDU2
• Protein Accession #: WP_026050270
• Nucleotide Accession #: NC_004459
• Molecular Weight: 21 kDa