NFUA Recombinant Protein (Vibrio vulnificus) (OPCA04405)

Catalog No: OPCA04405

Product Info

• Predicted Species Reactivity: Vibrio vulnificus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Vibrio vulnificus
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
  Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-194 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Complete genome sequence of Vibrio vulnificus CMCP6.Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).

Target Info

• Gene Symbol: NFUA
• Alias Symbols: nfuA, VV1_0864, Fe/S biogenesis protein NfuA
• NCBI Gene Id: 2622994
• Protein Name: Fe/S biogenesis protein NfuA
• Description of Target: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.UniRule annotation.
• Uniprot ID: Q8DDU2
• Protein Accession #: WP_026050270
• Nucleotide Accession #: NC_004459
• Protein Size (# AA): 1-194 aa
• Molecular Weight: 23 kDa