Catalog No: OPCA04401
Price: $0.00
SKU
OPCA04401
Availability: Domestic: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks | International: Antibody & Kits: 2 weeks | Proteins: 4-6 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NFUA Recombinant Protein (Vibrio vulnificus) (OPCA04401) (OPCA04401) |
---|
Predicted Species Reactivity | Vibrio vulnificus |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Vibrio vulnificus (strain CMCP6) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Protein Sequence | MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 1-194 aa |
Tag | N-terminal 6xHis-tagged |
Reference | Complete genome sequence of Vibrio vulnificus CMCP6.Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002). |
Gene Symbol | NFUA |
---|---|
Alias Symbols | nfuA, VV1_0864, Fe/S biogenesis protein NfuA |
NCBI Gene Id | 2622994 |
Protein Name | Fe/S biogenesis protein NfuA |
Description of Target | Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. |
Uniprot ID | Q8DDU2 |
Protein Accession # | WP_026050270 |
Nucleotide Accession # | NC_004459 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 25 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review