NFUA Recombinant Protein (Vibrio vulnificus) (OPCA04401)

Catalog No: OPCA04401

Product Info

• Predicted Species Reactivity: Vibrio vulnificus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Vibrio vulnificus (strain CMCP6)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
• Protein Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-194 aa
• Tag: N-terminal 6xHis-tagged
• Reference: Complete genome sequence of Vibrio vulnificus CMCP6.Rhee J.H., Kim S.Y., Chung S.S., Kim J.J., Moon Y.H., Jeong H., Choy H.E.Submitted (DEC-2002).

Target Info

• Gene Symbol: NFUA
• Alias Symbols: nfuA, VV1_0864, Fe/S biogenesis protein NfuA
• NCBI Gene Id: 2622994
• Protein Name: Fe/S biogenesis protein NfuA
• Description of Target: Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins.
• Uniprot ID: Q8DDU2
• Protein Accession #: WP_026050270
• Nucleotide Accession #: NC_004459
• Protein Size (# AA): Recombinant
• Molecular Weight: 25 kDa