Search Antibody, Protein, and ELISA Kit Solutions

NFKB2 Antibody - C-terminal region (ARP32043_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP32043_P050-FITC Conjugated

ARP32043_P050-HRP Conjugated

ARP32043_P050-Biotin Conjugated

Gene Symbol:
NFKB2
Official Gene Full Name:
Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
NCBI Gene Id:
4791
Protein Name:
Nuclear factor NF-kappa-B p100 subunit
Swissprot Id:
Q00653
Protein Accession #:
NP_002493
Nucleotide Accession #:
NM_002502
Alias Symbols:
p52, H2TF1, LYT10, LYT-10
Replacement Item:
This antibody may replace item sc-114, HPA008422
Description of Target:
NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.
Protein Size (# AA):
900
Molecular Weight:
97kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFKB2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFKB2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NFKB2
Predicted Species Reactivity:
Cow, Horse, Human, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 77%
Complete computational species homology data:
Anti-NFKB2 (ARP32043_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SDSDSDSEGPEKDTRSSFRGHTPLDLTCSTLVKTLLLNAAQNTMEPPL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FBXW11; UBC; RELB; RELA; REL; NFKB1; CHUK; BCL3; SUMO1; NEDD8; TNFAIP3; BIRC2; EPS8; VCP; UBD; BRRF1; COMMD1; COMMD2; MAP3K14; BTRC; NFKB2; FBXW7; TSG101; IKBKG; SUMO2; DPF2; PSMD11; NFKBIZ; TNIP2; HDAC5; NFKBIB; HDAC4; USP2; NFKBIE; RPL6; IKBKB; TSC22D3;
Blocking Peptide:
For anti-NFKB2 (ARP32043_P050) antibody is Catalog # AAP32043 (Previous Catalog # AAPP02945)
Datasheets/Manuals:
Printable datasheet for anti-NFKB2 (ARP32043_P050) antibody
Target Reference:
Xiao,G., et al., (2004) J. Biol. Chem. 279 (29), 30099-30105
Publications:

Volger, O. L. et al. Distinctive expression of chemokines and transforming growth factor-beta signaling in human arterial endothelium during atherosclerosis. Am. J. Pathol. 171, 326-37 (2007). IHC, WB, Cow, Horse, Human, Pig, Rabbit, Rat 17591977

Wang, C.-Y., Yang, P., Li, M. & Gong, F. Characterization of a negative feedback network between SUMO4 expression and NFkappaB transcriptional activity. Biochem. Biophys. Res. Commun. 381, 477-81 (2009). IHC, WB, Cow, Horse, Human, Pig, Rabbit, Rat 19222990

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...