Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP32043_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP32043_P050-FITC Conjugated

ARP32043_P050-HRP Conjugated

ARP32043_P050-Biotin Conjugated

NFKB2 Antibody - C-terminal region (ARP32043_P050)

Catalog#: ARP32043_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Horse, Human, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-114, HPA008422
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NFKB2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 92%; Rat: 77%
Complete computational species homology data Anti-NFKB2 (ARP32043_P050)
Peptide Sequence Synthetic peptide located within the following region: SDSDSDSEGPEKDTRSSFRGHTPLDLTCSTLVKTLLLNAAQNTMEPPL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NFKB2 (ARP32043_P050) antibody is Catalog # AAP32043 (Previous Catalog # AAPP02945)
Datasheets/Manuals Printable datasheet for anti-NFKB2 (ARP32043_P050) antibody
Target Reference Xiao,G., et al., (2004) J. Biol. Chem. 279 (29), 30099-30105
Publications

Volger, O. L. et al. Distinctive expression of chemokines and transforming growth factor-beta signaling in human arterial endothelium during atherosclerosis. Am. J. Pathol. 171, 326-37 (2007). IHC, WB, Cow, Horse, Human, Pig, Rabbit, Rat 17591977

Wang, C.-Y., Yang, P., Li, M. & Gong, F. Characterization of a negative feedback network between SUMO4 expression and NFkappaB transcriptional activity. Biochem. Biophys. Res. Commun. 381, 477-81 (2009). IHC, WB, Cow, Horse, Human, Pig, Rabbit, Rat 19222990

Gene Symbol NFKB2
Official Gene Full Name Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Alias Symbols p52, H2TF1, LYT10, LYT-10
NCBI Gene Id 4791
Protein Name Nuclear factor NF-kappa-B p100 subunit
Description of Target NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth.
Swissprot Id Q00653
Protein Accession # NP_002493
Nucleotide Accession # NM_002502
Protein Size (# AA) 900
Molecular Weight 97kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NFKB2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NFKB2.
Protein Interactions FBXW11; UBC; RELB; RELA; REL; NFKB1; CHUK; BCL3; SUMO1; NEDD8; TNFAIP3; BIRC2; EPS8; VCP; UBD; BRRF1; COMMD1; COMMD2; MAP3K14; BTRC; NFKB2; FBXW7; TSG101; IKBKG; SUMO2; DPF2; PSMD11; NFKBIZ; TNIP2; HDAC5; NFKBIB; HDAC4; USP2; NFKBIE; RPL6; IKBKB; TSC22D3;
  1. What is the species homology for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Horse, Human, Pig, Rabbit, Rat".

  2. How long will it take to receive "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFKB2 Antibody - C-terminal region (ARP32043_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    This target may also be called "p52, H2TF1, LYT10, LYT-10" in publications.

  5. What is the shipping cost for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "97kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFKB2 Antibody - C-terminal region (ARP32043_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NFKB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFKB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFKB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFKB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFKB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFKB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFKB2 Antibody - C-terminal region (ARP32043_P050)
Your Rating
We found other products you might like!