
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-NFKB1 (AVARP09048_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NFKB1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 85%; Rat: 78% |
Peptide Sequence | Synthetic peptide located within the following region: LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-NFKB1 (AVARP09048_P050) antibody is Catalog # AAP30581 (Previous Catalog # AAPP01233) |
Reference | Droll,L., (2008) Biochem. Biophys. Res. Commun. 371 (4), 626-629 |
Gene Symbol | NFKB1 |
---|---|
Gene Full Name | Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 |
Alias Symbols | KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta |
NCBI Gene Id | 4790 |
Protein Name | Nuclear factor NF-kappa-B p105 subunit |
Description of Target | NFKB1 is a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B.This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P19838-2 |
Protein Accession # | NP_003989 |
Nucleotide Accession # | NM_003998 |
Protein Size (# AA) | 969 |
Molecular Weight | 105kDa |
Protein Interactions | FBXW11; UBC; RELB; RELA; REL; NFKB2; HDAC1; BCL3; NFKB1; RPS3; HIF1AN; NFKBIA; MPP6; PELP1; PLD3; MXD3; IKBKG; RL2; TP63; SRF; MAP3K8; PML; SERPINA3; SPPL2A; TNIP2; NFKBIZ; COPS5; YWHAQ; RGS14; NR4A1; GLUL; ABCC2; TNIP1; COPB2; YY1; PARP1; RPS6KA5; BTRC; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".
-
How long will it take to receive "NFKB1 Antibody - middle region (AVARP09048_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NFKB1 Antibody - middle region (AVARP09048_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
This target may also be called "KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta" in publications.
-
What is the shipping cost for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "105kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NFKB1 Antibody - middle region (AVARP09048_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NFKB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NFKB1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NFKB1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NFKB1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NFKB1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NFKB1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.