Catalog No: AVARP09048_P050
Price: $0.00
SKU
AVARP09048_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFKB1 (AVARP09048_P050) antibody
Product Info
ReferenceDroll,L., (2008) Biochem. Biophys. Res. Commun. 371 (4), 626-629
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NFKB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 92%; Rabbit: 85%; Rat: 78%
Peptide SequenceSynthetic peptide located within the following region: LRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQEGPLEGK
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFKB1 (AVARP09048_P050) antibody is Catalog # AAP30581 (Previous Catalog # AAPP01233)
Gene SymbolNFKB1
Gene Full NameNuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Alias SymbolsKBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta
NCBI Gene Id4790
Protein NameNuclear factor NF-kappa-B p105 subunit
Description of TargetNFKB1 is a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B.This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP19838-2
Protein Accession #NP_003989
Nucleotide Accession #NM_003998
Protein Size (# AA)969
Molecular Weight105kDa
Protein InteractionsFBXW11; UBC; RELB; RELA; REL; NFKB2; HDAC1; BCL3; NFKB1; RPS3; HIF1AN; NFKBIA; MPP6; PELP1; PLD3; MXD3; IKBKG; RL2; TP63; SRF; MAP3K8; PML; SERPINA3; SPPL2A; TNIP2; NFKBIZ; COPS5; YWHAQ; RGS14; NR4A1; GLUL; ABCC2; TNIP1; COPB2; YY1; PARP1; RPS6KA5; BTRC;
  1. What is the species homology for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFKB1 Antibody - middle region (AVARP09048_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    This target may also be called "KBF1, EBP-1, NF-kB, CVID12, NF-kB1, NFKB-p50, NFkappaB, NF-kappaB, NFKB-p105, NF-kappa-B1, NF-kappabeta" in publications.

  5. What is the shipping cost for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "105kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFKB1 Antibody - middle region (AVARP09048_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFKB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFKB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFKB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFKB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFKB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFKB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFKB1 Antibody - middle region (AVARP09048_P050)
Your Rating
We found other products you might like!