Loading...
Catalog No: P100976_P050
Price: $0.00
SKU
P100976_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFIC (P100976_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Western analysis of MCF7 cell lysate.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NFIC
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: KSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSIL
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFIC (P100976_P050) antibody is Catalog # AAP31021 (Previous Catalog # AAPP01754)
ReferenceHebert,S.L., Biochim. Biophys. Acta 1769 (11-12), 649-658 (2007)
Description
Gene SymbolNFIC
Gene Full NameNuclear factor I/C (CCAAT-binding transcription factor)
Alias SymbolsCTF, NFI, CTF5, NF-I
NCBI Gene Id4782
Protein NameNuclear factor 1 RuleBase RU000690
Description of TargetBrg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.
Uniprot IDQ6FI30
Protein Accession #NP_995315
Nucleotide Accession #NM_205843
Protein Size (# AA)499
Molecular Weight55kDa
Protein InteractionsHSP90AA1; TFAP4; Cebpb; ELAVL1; SUMO2; UBC; SMURF1; SMAD3; ZCCHC14; ZKSCAN7; TPD52L3; TKTL2; LLPH; NFIB; GLRX; CREBBP; RFX1; TLX1;
  1. What is the species homology for "NFIC Antibody - middle region (P100976_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig".

  2. How long will it take to receive "NFIC Antibody - middle region (P100976_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFIC Antibody - middle region (P100976_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFIC Antibody - middle region (P100976_P050)"?

    This target may also be called "CTF, NFI, CTF5, NF-I" in publications.

  5. What is the shipping cost for "NFIC Antibody - middle region (P100976_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFIC Antibody - middle region (P100976_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFIC Antibody - middle region (P100976_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFIC Antibody - middle region (P100976_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFIC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFIC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFIC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFIC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFIC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFIC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFIC Antibody - middle region (P100976_P050)
Your Rating
We found other products you might like!