NFIC Antibody - middle region (P100759_P050)

Catalog No: P100759_P050

WB Suggested Anti-NFIC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysateNFIC is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFIC
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Human: 100%; Pig: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MLAPPPPGLPRLALPPATKPATTSEGGATSPTSPSYSPPDTSPANRSFVG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NFIC (P100759_P050) antibody is Catalog # AAP31081 (Previous Catalog # AAPP01820)
• Sample Type Confirmation:

  NFIC is supported by BioGPS gene expression data to be expressed in 721_B

Target Info

• Reference: Hebert,S.L., Biochim. Biophys. Acta 1769 (11-12), 649-658 (2007)
• Gene Symbol: NFIC
• Gene Full Name: Nuclear factor I/C (CCAAT-binding transcription factor)
• Alias Symbols: CTF, NFI, CTF5, NF-I
• NCBI Gene Id: 4782
• Protein Name: Nuclear factor 1 RuleBase RU000690
• Description of Target: Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.
• Uniprot ID: Q6FI30
• Protein Accession #: NP_995315
• Nucleotide Accession #: NM_205843
• Protein Size (# AA): 499
• Molecular Weight: 55kDa
• Protein Interactions: HSP90AA1; TFAP4; Cebpb; ELAVL1; SUMO2; UBC; SMURF1; SMAD3; ZCCHC14; ZKSCAN7; TPD52L3; TKTL2; LLPH; NFIB; GLRX; CREBBP; RFX1; TLX1;