Catalog No: P100819_T100-HRP
Size:100ul
Price: $384.00
SKU
P100819_T100-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)

Datasheets/ManualsPrintable datasheet for anti-NFIC (P100819_T100-HRP) antibody
Product Info
ReferenceZhao,L.H., et al., (2005) Acta Biochim. Biophys. Sin. (Shanghai) 37 (7), 440-446
Publications

Liang, B., Tikhanovich, I., Nasheuer, H. P. & Folk, W. R. Stimulation of BK virus DNA replication by NFI family transcription factors. J. Virol. 86, 3264-75 (2012). WB, IP, EMSA, Human 22205750

Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human NFIC
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFIC (P100819_T100-HRP) antibody is Catalog # AAP31167 (Previous Catalog # AAPP01910)
Gene SymbolNFIC
Gene Full NameNuclear factor I/C (CCAAT-binding transcription factor)
Alias SymbolsCTF, NFI, CTF5, NF-I
NCBI Gene Id4782
Protein NameNuclear factor 1 C-type
Description of TargetBrg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.
Uniprot IDP08651
Protein Accession #NP_005588
Nucleotide Accession #NM_005597
Protein Size (# AA)428
Molecular Weight48kDa
Protein InteractionsHSP90AA1; TFAP4; Cebpb; ELAVL1; SUMO2; UBC; SMURF1; SMAD3; ZCCHC14; ZKSCAN7; TPD52L3; TKTL2; LLPH; NFIB; GLRX; CREBBP; RFX1; TLX1;
  1. What is the species homology for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    This target may also be called "CTF, NFI, CTF5, NF-I" in publications.

  5. What is the shipping cost for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFIC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFIC"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFIC"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFIC"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFIC"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFIC"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFIC Antibody - C-terminal region : HRP (P100819_T100-HRP)
Your Rating
We found other products you might like!