SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: P100780_P050
Price: $0.00
SKU
P100780_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFE2L1 (P100780_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human NFE2L1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFE2L1 (P100780_P050) antibody is Catalog # AAPP01949
ReferenceWang,W., (2007) J. Biol. Chem. 282 (34), 24670-24678
Gene SymbolNFE2L1
Gene Full NameNuclear factor (erythroid-derived 2)-like 1
Alias SymbolsNRF1, TCF11, LCR-F1
NCBI Gene Id4779
Protein NameNuclear factor erythroid 2-related factor 1
Description of TargetNFE2L1 activates erythroid-specific, globin gene expression. This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c
Uniprot IDQ14494
Protein Accession #NP_003195
Nucleotide Accession #NM_003204
Protein Size (# AA)772
Molecular Weight85kDa
Protein InteractionsUBC; KEAP1; NFE2L1; MAFG; BACH2; CREBZF; MAFF; NFE2L3; FBXW7; GSK3B; CAPN1; CD6; SUMO2; HCFC1; ATF4; MAFK; JUND; JUNB; JUN;
  1. What is the species homology for "NFE2L1 Antibody - middle region (P100780_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog".

  2. How long will it take to receive "NFE2L1 Antibody - middle region (P100780_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFE2L1 Antibody - middle region (P100780_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFE2L1 Antibody - middle region (P100780_P050)"?

    This target may also be called "NRF1, TCF11, LCR-F1" in publications.

  5. What is the shipping cost for "NFE2L1 Antibody - middle region (P100780_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFE2L1 Antibody - middle region (P100780_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFE2L1 Antibody - middle region (P100780_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "85kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFE2L1 Antibody - middle region (P100780_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFE2L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFE2L1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFE2L1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFE2L1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFE2L1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFE2L1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFE2L1 Antibody - middle region (P100780_P050)
Your Rating
We found other products you might like!