Aviva Systems Biology office will be closed for Christmas and New Year Holiday - December 24-25, 2018 and January 1, 2019.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NFATC4 antibody - N-terminal region (ARP38493_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP38493_P050-FITC Conjugated

ARP38493_P050-HRP Conjugated

ARP38493_P050-Biotin Conjugated

Gene Symbol:
NFATC4
NCBI Gene Id:
4776
Official Gene Full Name:
Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
Protein Name:
Nuclear factor of activated T-cells, cytoplasmic 4
Swissprot Id:
Q14934
Protein Accession #:
NP_004545
Nucleotide Accession #:
NM_004554
Alias Symbols:
NF-ATc4, NFAT3
Replacement Item:
This antibody may replace item sc-1149 from Santa Cruz Biotechnology.
Description of Target:
NFATC4 is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. NFATC4 plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4.The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family of nuclear factors of activated T cells also participate in the formation of this complex. The product of this gene plays a role in the inducible expression of cytokine genes in T cells, especially in the induction of the IL-2 and IL-4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
902
Molecular Weight:
95kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFATC4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFATC4.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC4
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NFATC4 (ARP38493_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ANKRD28; Dlg4; NR1I2; MAPK9; MAPK8; JUP; GPR22; CCNG1; LPIN1; CEBPA; GATA4; YWHAZ; MAPK14; CREBBP; YWHAQ;
Blocking Peptide:
For anti-NFATC4 (ARP38493_P050) antibody is Catalog # AAP38493 (Previous Catalog # AAPS04304)
Datasheets/Manuals:
Printable datasheet for anti-NFATC4 (ARP38493_P050) antibody
Target Reference:
Diedrichs,H., (2007) J. Int. Med. Res. 35 (6), 803-818

Tell us what you think about this item!

Write A Review
    Please, wait...