Search Antibody, Protein, and ELISA Kit Solutions

NFATC3 Antibody - N-terminal region : FITC (ARP72414_P050-FITC)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72414_P050 Unconjugated

ARP72414_P050-HRP Conjugated

ARP72414_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Swissprot Id:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-1149 from Santa Cruz Biotechnology.
Description of Target:
The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFATC3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFATC3.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NFATC3
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: LSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NFATC3 (ARP72414_P050-FITC) antibody is Catalog # AAP72414
Printable datasheet for anti-NFATC3 (ARP72414_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...