Search Antibody, Protein, and ELISA Kit Solutions

NFATC2 Antibody - N-terminal region (ARP37106_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37106_T100-FITC Conjugated

ARP37106_T100-HRP Conjugated

ARP37106_T100-Biotin Conjugated

Gene Symbol:
NFATC2
Official Gene Full Name:
Nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 2
NCBI Gene Id:
18019
Protein Name:
Nuclear factor of activated T-cells, cytoplasmic 2
Swissprot Id:
Q60591-3
Protein Accession #:
NP_035029
Nucleotide Accession #:
NM_010899
Alias Symbols:
NFAT1, Nfatp, NF-ATc2, NFAT1-D, AI607462
Replacement Item:
This antibody may replace item sc-1149 from Santa Cruz Biotechnology.
Description of Target:
NFATC2 is a member of The NF-AT family of potent transcription factors that are essential for T cell activation
Protein Size (# AA):
927
Molecular Weight:
100kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFATC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFATC2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of mouse NFATC2
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 82%; Horse: 93%; Human: 93%; Mouse: 100%; Pig: 79%; Rat: 93%
Complete computational species homology data:
Anti-NFATC2 (ARP37106_T100)
Peptide Sequence:
Synthetic peptide located within the following region: MDVPEPQPDPDGGDGPGHEPGGSPQDELDFSILFDYDYLNPIEEEPIAHK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Foxp3; Il4; Ifng; Nfatc2ip;
Blocking Peptide:
For anti-NFATC2 (ARP37106_T100) antibody is Catalog # AAP37106 (Previous Catalog # AAPP09334)
Datasheets/Manuals:
Printable datasheet for anti-NFATC2 (ARP37106_T100) antibody
Target Reference:
Glud,S.Z., et al., (2005) Blood 106 (10), 3546-3552
Publications:

Heer, R. et al. Phenotypic modulation of human urinary tract stroma-derived fibroblasts by transforming growth factor beta3. Urology 76, 509.e13-20 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat 20546875

Nagamoto-Combs, K. & Combs, C. K. Microglial phenotype is regulated by activity of the transcription factor, NFAT (nuclear factor of activated T cells). J. Neurosci. 30, 9641-6 (2010). WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat 20631193

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...