Search Antibody, Protein, and ELISA Kit Solutions

NFATC2 Antibody - C-terminal region : FITC (ARP38988_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP38988_P050 Unconjugated

ARP38988_P050-HRP Conjugated

ARP38988_P050-Biotin Conjugated

Gene Symbol:
NFATC2
Official Gene Full Name:
Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2
NCBI Gene Id:
4773
Protein Name:
Nuclear factor of activated T-cells, cytoplasmic 2
Swissprot Id:
Q13469
Protein Accession #:
NP_775114
Nucleotide Accession #:
NM_173091
Alias Symbols:
NFAT1, NFATP
Replacement Item:
This antibody may replace item sc-1149 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the nuclear factor of activated T cells (NFAT) family. The product of this gene is a DNA-binding protein with a REL-homology region (RHR) and an NFAT-homology region (NHR). This protein is present in the cytosol and only translocates to the nucleus upon T cell receptor (TCR) stimulation, where it becomes a member of the nuclear factors of activated T cells transcription complex. This complex plays a central role in inducing gene transcription during the immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Protein Size (# AA):
925
Molecular Weight:
100kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NFATC2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NFATC2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human NFATC2
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-NFATC2 (ARP38988_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
GNB2; USP22; UBC; TNPO1; CSE1L; LRRK2; IQGAP1; PPP2R1A; JUN; NFATC2; CREBBP; IRF2BP2; TFAP4; HNRNPA1; TAF9; TUBA1A; KPNB1; SUV39H1; MAPK9; MAPK8; MED31; NFATC2IP; EP300; IRF4; PPP3R1; YWHAZ; PIN1; MEF2D; FOXP3; VIM; PRKCZ; YWHAQ; EGR4; EGR1; PPP3CB;
Blocking Peptide:
For anti-NFATC2 (ARP38988_P050-FITC) antibody is Catalog # AAP38988 (Previous Catalog # AAPP22972)
Datasheets/Manuals:
Printable datasheet for anti-NFATC2 (ARP38988_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...