Loading...
Catalog No: P100981_P050
Price: $0.00
SKU
P100981_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NFATC1 (P100981_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Dog, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 91%; Guinea Pig: 84%; Human: 100%; Mouse: 91%
Peptide SequenceSynthetic peptide located within the following region: MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASS
Concentration0.5 mg/ml
Blocking PeptideFor anti-NFATC1 (P100981_P050) antibody is Catalog # AAP31109 (Previous Catalog # AAPP01848)
ReferenceCrotti,T.N., (2008) J. Cell. Physiol. 215 (3), 636-644
Description
Gene SymbolNFATC1
Gene Full NameNuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 1
Alias SymbolsNFAT2, NFATc, NF-ATC, NF-ATc1.2
NCBI Gene Id4772
Protein NameNuclear factor of activated T-cells, cytoplasmic 1
Description of TargetNFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes. The product of this gene is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Five transcript variants encoding distinct isoforms have been identified for this gene. Different isoforms of this protein may regulate inducible expression of different cytokine genes.
Uniprot IDO95644-2
Protein Accession #NP_765978
Nucleotide Accession #NM_172390
Protein Size (# AA)716
Molecular Weight78kDa
Protein InteractionsYWHAQ; OGT; PML; GZF1; FOXP3; HDAC4; PIAS1; SUMO1; UBE2I; RPS6KB1; RPS6KA3; HDAC2; HDAC1; HNRNPA1; TUBA1A; KPNB1; HDAC5; KAT2B; EP300; PARP1; HDAC3; PPP3R1; MAPK14; GNB2L1; PRKCA; SPI1; PIM1; EGR2; EGR1;
  1. What is the species homology for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Dog, Guinea Pig".

  2. How long will it take to receive "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NFATC1 Antibody - N-terminal region (P100981_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    This target may also be called "NFAT2, NFATc, NF-ATC, NF-ATc1.2" in publications.

  5. What is the shipping cost for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "78kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NFATC1 Antibody - N-terminal region (P100981_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NFATC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NFATC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NFATC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NFATC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NFATC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NFATC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NFATC1 Antibody - N-terminal region (P100981_P050)
Your Rating
We found other products you might like!