- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for NFAT5 Antibody (Phospho-Ser1197) (OAAF07660) |
---|
Predicted Species Reactivity | Human|Mouse |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence |
Additional Information | Modification Sites: Human:S1197 Mouse:S1197 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human NFAT5 around the phosphorylation site of Ser1197. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: QSTSNSEQQAAFQQQAPISHIQTPMLSQEQAQPPQQGLFQPQVALGSLPP |
Concentration | 1mg/ml |
Specificity | NFAT5 (Phospho-Ser1197) Antibody detects endogenous levels of NFAT5 only when phosphorylated at Ser1197. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IF: 1:100~1:500 ELISA: 1:1000 |
Gene Symbol | NFAT5 |
---|---|
Gene Full Name | nuclear factor of activated T cells 5 |
Alias Symbols | glutamine rich protein H65;NF-AT5;NFATL1;NFAT-like protein 1;NFATZ;nuclear factor of activated T-cells 5;nuclear factor of activated T-cells 5, tonicity-responsive;OREBP;osmotic response element-binding protein;T-cell transcription factor NFAT5;TonE-binding protein;TONEBP;tonicity-responsive enhancer-binding protein. |
NCBI Gene Id | 10725 |
Protein Name | Nuclear factor of activated T-cells 5 |
Description of Target | Transcription factor involved, among others, in the transcriptional regulation of osmoprotective and inflammatory genes. Mediates the transcriptional response to hypertonicity (PubMed:10051678). Positively regulates the transcription of LCN2 and S100A4 genes; optimal transactivation of these genes requires the presence of DDX5/DDX17 (PubMed:22266867). Binds the DNA consensus sequence 5'-[ACT][AG]TGGAAA[CAT]A[TA][ATC][CA][ATG][GT][GAC][CG][CT]-3' (PubMed:10377394). |
Uniprot ID | O94916 |
Molecular Weight | 165 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
This target may also be called "glutamine rich protein H65;NF-AT5;NFATL1;NFAT-like protein 1;NFATZ;nuclear factor of activated T-cells 5;nuclear factor of activated T-cells 5, tonicity-responsive;OREBP;osmotic response element-binding protein;T-cell transcription factor NFAT5;TonE-binding protein;TONEBP;tonicity-responsive enhancer-binding protein." in publications.
-
What is the shipping cost for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "165 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NFAT5 Antibody (Phospho-Ser1197) (OAAF07660)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NFAT5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NFAT5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NFAT5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NFAT5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NFAT5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NFAT5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.