NFAT5 Antibody - middle region (ARP38831_P050)

Catalog No: ARP38831_P050

WB Suggested Anti-NFAT5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFAT5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NFAT5 (ARP38831_P050) antibody is Catalog # AAP38831 (Previous Catalog # AAPP23409)
• Reference: Zhou,X., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (14), 5620-5625

Target Info

• Gene Symbol: NFAT5
• Gene Full Name: Nuclear factor of activated T-cells 5, tonicity-responsive
• Alias Symbols: NFATZ, OREBP, NF-AT5, NFATL1, TONEBP
• NCBI Gene Id: 10725
• Protein Name: Nuclear factor of activated T-cells 5
• Description of Target: NFAT5 is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements.The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: O94916
• Protein Accession #: NP_006590
• Nucleotide Accession #: NM_006599
• Protein Size (# AA): 1531
• Molecular Weight: 166kDa
• Protein Interactions: gag-pol; SUMO2; TBC1D4; NFAT5; FOXP3;