- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847) |
|---|
| Predicted Species Reactivity | Human|Mouse |
|---|---|
| Product Format | Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:S168+S170 Mouse:S168+S170 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NFAT3 around the phosphorylation site of Ser168 and Ser170. |
| Purification | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
| Peptide Sequence | Synthetic peptide located within the following region: DAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDA |
| Concentration | 1 mg/ml |
| Specificity | Phospho-NFATc4 (S168/S170) Polyclonal Antibody detects endogenous levels of NFATc4 protein only when phosphorylated at S168/S170. |
| Application Info | WB: 1/500 - 1/2000 IHC: 1/100 - 1/300 ELISA: 1/5000 |
| Gene Symbol | NFATC4 |
|---|---|
| Gene Full Name | nuclear factor of activated T cells 4 |
| Alias Symbols | NFAT3;NF-AT3;NF-ATC4;nuclear factor of activated T-cells, cytoplasmic 4;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4;T-cell transcription factor NFAT3. |
| NCBI Gene Id | 4776 |
| Protein Name | Nuclear factor of activated T-cells, cytoplasmic 4 |
| Description of Target | Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 and IL-4. Transcriptionally repressed by estrogen receptors; this inhibition is further enhanced by estrogen. Increases the transcriptional activity of PPARG and has a direct role in adipocyte differentiation. May play an important role in myotube differentiation. May play a critical role in cardiac development and hypertrophy. May play a role in deafferentation-induced apoptosis of sensory neurons. |
| Uniprot ID | Q14934 |
| Molecular Weight | 95 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)" provided in?
This item is provided in "Liquid PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
This target may also be called "NFAT3;NF-AT3;NF-ATC4;nuclear factor of activated T-cells, cytoplasmic 4;nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4;T-cell transcription factor NFAT3." in publications.
-
What is the shipping cost for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "95 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NFAT3 Antibody (Phospho-Ser168+Ser170) (OAAF07847)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NFATC4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NFATC4"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NFATC4"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NFATC4"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NFATC4"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NFATC4"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
