NEU1 Antibody - middle region (ARP44286_T100)

Catalog No: ARP44286_T100

Host: Rabbit
Target Name: NEU1
Sample Tissue: Human ACHN
Antibody Dilution: 1.0ug/ml

Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Fetal pancreas cell lysate. Antibody concentration: 5.0 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NEU1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-NEU1 (ARP44286_T100) antibody is Catalog # AAP44286 (Previous Catalog # AAPP25666)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Hinek,A., (2006) J. Biol. Chem. 281 (6), 3698-3710
• Publications:

  Lipopolysaccharide activates microglia via neuraminidase 1 desialylation of Toll-like Receptor 4. J Neurochem. 155, 403-416 (2020) 32279315

• Description:
  View product citations for NEU1 Antibody - middle region (ARP44286_T100) on CiteAb

Target Info

• Gene Symbol: NEU1
• Gene Full Name: Sialidase 1 (lysosomal sialidase)
• Alias Symbols: NEU, NANH, SIAL1
• NCBI Gene Id: 4758
• Protein Name: Sialidase-1
• Description of Target: NEU1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A. Mutations in NEU1 gene can lead to sialidosis.The protein encoded by this gene encodes the lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis.
• Uniprot ID: Q99519
• Protein Accession #: NP_000425
• Nucleotide Accession #: NM_000434
• Protein Size (# AA): 415
• Molecular Weight: 45 kDa
• Protein Interactions: FBXO6; JUNB; LIG4; KCNA4; KCNA2; UBC; HDAC5; CTSA; GLB1; EEF1A1; GALNS;