- Gene Symbol:
- NETO2
- NCBI Gene Id:
- 81831
- Official Gene Full Name:
- Neuropilin (NRP) and tolloid (TLL)-like 2
- Protein Name:
- Neuropilin and tolloid-like protein 2
- Swissprot Id:
- Q8NC67
- Protein Accession #:
- NP_060562
- Nucleotide Accession #:
- NM_018092
- Alias Symbols:
- FLJ10430, FLJ14724, FLJ90456, NEOT2, BTCL2
- Replacement Item:
- This antibody may replace item sc-292088, HPA013180
- Description of Target:
- NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
- Protein Size (# AA):
- 525
- Molecular Weight:
- 57kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express NETO2.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express NETO2.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
- Complete computational species homology data:
- Anti-NETO2 (ARP47391_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- ELAVL1;
- Blocking Peptide:
- For anti-NETO2 (ARP47391_P050) antibody is Catalog # AAP47391 (Previous Catalog # AAPP28257)
- Datasheets/Manuals:
- Printable datasheet for anti-NETO2 (ARP47391_P050) antibody
- Sample Type Confirmation:
NETO2 is supported by BioGPS gene expression data to be expressed in 721_B
- Target Reference:
- Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
