Search Antibody, Protein, and ELISA Kit Solutions

NETO2 Antibody - N-terminal region (ARP47391_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP47391_P050-FITC Conjugated

ARP47391_P050-HRP Conjugated

ARP47391_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-292088, HPA013180
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NETO2 (ARP47391_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NETO2 (ARP47391_P050) antibody is Catalog # AAP47391 (Previous Catalog # AAPP28257)
Datasheets/Manuals:
Printable datasheet for anti-NETO2 (ARP47391_P050) antibody
Sample Type Confirmation:

NETO2 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
Gene Symbol:
NETO2
Official Gene Full Name:
Neuropilin (NRP) and tolloid (TLL)-like 2
Alias Symbols:
FLJ10430, FLJ14724, FLJ90456, NEOT2, BTCL2
NCBI Gene Id:
81831
Protein Name:
Neuropilin and tolloid-like protein 2
Description of Target:
NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
Swissprot Id:
Q8NC67
Protein Accession #:
NP_060562
Nucleotide Accession #:
NM_018092
Protein Size (# AA):
525
Molecular Weight:
57kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NETO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NETO2.
Protein Interactions:
ELAVL1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...