NETO2 Antibody - N-terminal region (ARP47391_P050)

Catalog#: ARP47391_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-292088, HPA013180
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-NETO2 (ARP47391_P050) antibody is Catalog # AAP47391 (Previous Catalog # AAPP28257)
• Sample Type Confirmation:

  NETO2 is supported by BioGPS gene expression data to be expressed in 721_B

• Target Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824
• Gene Symbol: NETO2
• Official Gene Full Name: Neuropilin (NRP) and tolloid (TLL)-like 2
• Alias Symbols: FLJ10430, FLJ14724, FLJ90456, NEOT2, BTCL2
• NCBI Gene Id: 81831
• Protein Name: Neuropilin and tolloid-like protein 2
• Description of Target: NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
• Swissprot Id: Q8NC67
• Protein Accession #: NP_060562
• Nucleotide Accession #: NM_018092
• Protein Size (# AA): 525
• Molecular Weight: 57kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express NETO2.
• Protein Interactions: ELAVL1;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: NETO2 antibody tested with Human 721_B_Lymphoblast (ARP47391_P050)

Product Protocol: Rabbit Anti-NETO2 Antibody (ARP47391_P050) in Human Bronchial Epithelial Tissue using Immunohistochemistry