Now Offering Over 102,157 Antibodies & 44,722 Antigens!

NETO2 antibody - N-terminal region (ARP47391_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP47391_P050-FITC Conjugated

ARP47391_P050-HRP Conjugated

ARP47391_P050-Biotin Conjugated

Gene Symbol:
NETO2
NCBI Gene Id:
81831
Official Gene Full Name:
Neuropilin (NRP) and tolloid (TLL)-like 2
Protein Name:
Neuropilin and tolloid-like protein 2
Swissprot Id:
Q8NC67
Protein Accession #:
NP_060562
Nucleotide Accession #:
NM_018092
Alias Symbols:
FLJ10430, FLJ14724, FLJ90456, NEOT2, BTCL2
Replacement Item:
This antibody may replace item sc-292088, HPA013180
Description of Target:
NETO2 is a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
Protein Size (# AA):
525
Molecular Weight:
57kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NETO2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NETO2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human NETO2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NETO2 (ARP47391_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAKIYLRFLDYQME
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
ELAVL1;
Blocking Peptide:
For anti-NETO2 (ARP47391_P050) antibody is Catalog # AAP47391 (Previous Catalog # AAPP28257)
Datasheets/Manuals:
Printable datasheet for anti-NETO2 (ARP47391_P050) antibody
Sample Type Confirmation:

NETO2 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Tell us what you think about this item!

Write A Review
    Please, wait...