NETO1 Antibody - C-terminal region (ARP59810_P050)

Catalog No: ARP59810_P050

WB Suggested Anti-NETO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Host: Rabbit
Target: NETO1
Positive control (+): Human Brain (BR)
Negative control (-): HeLa Cell Lysate (HL)
Antibody concentration: 1ug/ml

Immunohistochemistry with mice retinal neurons tissue at an antibody concentration of researcher doesn't say using anti-NETO1 antibody (ARP59810_P050)

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NETO1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NETO1 (ARP59810_P050) antibody is Catalog # AAP59810 (Previous Catalog # AAPP45969)

Target Info

• Gene Symbol: NETO1
• Gene Full Name: Neuropilin (NRP) and tolloid (TLL)-like 1
• Alias Symbols: BCTL1, BTCL1
• NCBI Gene Id: 81832
• Protein Name: Neuropilin and tolloid-like protein 1
• Description of Target: This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in mice encodes a protein that plays a critical role in spatial learning and memory by regulating the function of synaptic N-methyl-D-aspartic acid receptor complexes in the hippocampus. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Uniprot ID: Q8R4I7
• Protein Accession #: NP_620416
• Nucleotide Accession #: NM_138966
• Protein Size (# AA): 533
• Molecular Weight: 60kDa
• Protein Interactions: BAG3;