Search Antibody, Protein, and ELISA Kit Solutions

NEK6 antibody - N-terminal region (ARP48756_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48756_P050-FITC Conjugated

ARP48756_P050-HRP Conjugated

ARP48756_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
NIMA (never in mitosis gene a)-related kinase 6
Protein Name:
Serine/threonine-protein kinase Nek6
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-134833 from Santa Cruz Biotechnology.
Description of Target:
The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NEK6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NEK6.
The immunogen is a synthetic peptide directed towards the N terminal region of human NEK6
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Complete computational species homology data:
Anti-NEK6 (ARP48756_P050)
Peptide Sequence:
Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NEK6 (ARP48756_P050) antibody is Catalog # AAP48756 (Previous Catalog # AAPP28807)
Printable datasheet for anti-NEK6 (ARP48756_P050) antibody
Target Reference:
Lee,E.J., (2007) Biochem. Biophys. Res. Commun. 358 (3), 783-788

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...