SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP64291_P050
Price: $0.00
SKU
ARP64291_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NDUFS4 (ARP64291_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFS
Concentration0.5 mg/ml
Blocking PeptideFor anti-NDUFS4 (ARP64291_P050) antibody is Catalog # AAP64291
Gene SymbolNDUFS4
Gene Full NameNADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Alias SymbolsAQDQ, CI-18, MC1DN1, CI-AQDQ, CI-18 kDa
NCBI Gene Id4724
Protein NameNADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Description of TargetThis gene encodes an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), or NADH:ubiquinone oxidoreductase, the first multi-subunit enzyme complex of the mitochondrial respiratory chain. Complex I plays a vital role in cellular ATP production, the primary source of energy for many crucial processes in living cells. It removes electrons from NADH and passes them by a series of different protein-coupled redox centers to the electron acceptor ubiquinone. In well-coupled mitochondria, the electron flux leads to ATP generation via the building of a proton gradient across the inner membrane. Complex I is composed of at least 41 subunits, of which 7 are encoded by the mitochondrial genome and the remainder by nuclear genes.
Uniprot IDO43181
Protein Accession #NP_002486
Nucleotide Accession #NM_002495
Protein Size (# AA)175
Molecular Weight20kDa
Protein InteractionsPARK2; UBE2G2; NDUFS7; MARC1; NDUFA12; MRPL15; NDUFAF3; NUP188; TOMM20; UQCRB; RPS2; ABCD3; PRPH; NDUFS6; NDUFB5; MGST3; M6PR; DLAT; CYC1; COX15; CACNA2D1; ATP5O; APP; UBC;
  1. What is the species homology for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NDUFS4 Antibody - middle region (ARP64291_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    This target may also be called "AQDQ, CI-18, MC1DN1, CI-AQDQ, CI-18 kDa" in publications.

  5. What is the shipping cost for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NDUFS4 Antibody - middle region (ARP64291_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NDUFS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NDUFS4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NDUFS4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NDUFS4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NDUFS4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NDUFS4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NDUFS4 Antibody - middle region (ARP64291_P050)
Your Rating