Ndufs1 Antibody - N-terminal region (ARP56608_P050)

Catalog No: ARP56608_P050

Host: Rabbit
Target Name: Ndufs1
Sample Type: Rat Thymus lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ndufs1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Goat: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request
• Subunit: , mitochondrial

Target Info

• Gene Symbol: Ndufs1
• Gene Full Name: NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase)
• Alias Symbols: -
• NCBI Gene Id: 301458
• Protein Name: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
• Description of Target: Ndufs1 is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.
• Uniprot ID: Q66HF1
• Protein Accession #: NP_001005550
• Nucleotide Accession #: NM_001005550
• Protein Size (# AA): 727
• Molecular Weight: 79kDa
• Protein Interactions: STXBP5L; Gja1;