Search Antibody, Protein, and ELISA Kit Solutions

NDUFB7 Antibody - middle region (ARP82995_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
NDUFB7
Official Gene Full Name:
NADH:ubiquinone oxidoreductase subunit B7
NCBI Gene Id:
4713
Protein Name:
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
Swissprot Id:
P17568
Protein Accession #:
NP_004137.2
Nucleotide Accession #:
NM_004146.5
Alias Symbols:
B18, CI-B18
Description of Target:
The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Protein Size (# AA):
137
Molecular Weight:
15 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NDUFB7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NDUFB7.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NDUFB7
Peptide Sequence:
Synthetic peptide located within the following region: KCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREK
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NDUFB7 (ARP82995_P050) antibody is Catalog # AAP82995
Datasheets/Manuals:
Printable datasheet for anti-NDUFB7 (ARP82995_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...