SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62418_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NDUFA8 (ARP62418_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: LKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQI
Concentration0.5 mg/ml
Blocking PeptideFor anti-NDUFA8 (ARP62418_P050) antibody is Catalog # AAP62418
Sample Type Confirmation

NDUFA8 is supported by BioGPS gene expression data to be expressed in COLO205

Gene SymbolNDUFA8
Gene Full NameNADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Alias SymbolsPGIV, CI-19KD, CI-PGIV
NCBI Gene Id4702
Protein NameNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Description of TargetThe protein encoded by this gene belongs to the complex I 19 kDA subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Uniprot IDP51970
Protein Accession #NP_055037
Nucleotide Accession #NM_014222
Protein Size (# AA)172
Molecular Weight19kDa
Protein InteractionsUBC; RNF31; KDM1A; MYC;
  1. What is the species homology for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NDUFA8 Antibody - N-terminal region (ARP62418_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    This target may also be called "PGIV, CI-19KD, CI-PGIV" in publications.

  5. What is the shipping cost for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "19kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NDUFA8 Antibody - N-terminal region (ARP62418_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NDUFA8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NDUFA8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NDUFA8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NDUFA8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NDUFA8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NDUFA8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NDUFA8 Antibody - N-terminal region (ARP62418_P050)
Your Rating
We found other products you might like!