NDUFA8 Antibody - middle region (ARP83284_P050)

Catalog No: ARP83284_P050

Host: Rabbit
Target Name: NDUFA8
Sample Tissue: Human Hela Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFA8
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NDUFA8 (ARP83284_P050) antibody is Catalog # AAP83284

Target Info

• Gene Symbol: NDUFA8
• Gene Full Name: NADH:ubiquinone oxidoreductase subunit A8
• Alias Symbols: PGIV, CI-19KD, CI-PGIV
• NCBI Gene Id: 4702
• Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
• Description of Target: The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
• Uniprot ID: P51970
• Protein Accession #: NP_055037.1
• Nucleotide Accession #: NM_014222.2
• Protein Size (# AA): 172
• Molecular Weight: 20 kDa