NDUFA5 Antibody (OAAL00210)

Catalog No: OAAL00210

Size:100UG

NDUFA5 monoclonal antibody (M02), clone 4A2. Western Blot analysis of NDUFA5 expression in human kidney.

Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 monoclonal antibody (M02), clone 4A2.
Lane 1: NDUFA5 transfected lysate(13.5 KDa).
Lane 2: Non-transfected lysate.

Immunoperoxidase of monoclonal antibody to NDUFA5 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]

Detection limit for recombinant GST tagged NDUFA5 is 10 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 4A2
• Isotype: IgG1 Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: NDUFA5
• Gene Full Name: NADH:ubiquinone oxidoreductase subunit A5
• Alias Symbols: B13;CI-13kB;CI-13KD-B;complex I 13kDa subunit B;complex I subunit B13;NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5;NADH-ubiquinone oxidoreductase 13 kDa-B subunit;NUFM;type I dehydrogenase;ubiquinone reductase;UQOR13.
• NCBI Gene Id: 4698
• Protein Name: Homo sapiens NADH:ubiquinone oxidoreductase subunit A5 (NDUFA5), transcript variant 1, mRNA|NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 isoform 1 [Homo sapiens]
• Description of Target: The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown. It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid. The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form. The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal. Related pseudogenes have also been identified on four other chromosomes. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_004991.1
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_005000.2