Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP75565_P050 Unconjugated

ARP75565_P050-HRP Conjugated

ARP75565_P050-Biotin Conjugated

NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)

Catalog#: ARP75565_P050-FITC
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Clonality Polyclonal
Host Rabbit
Conjugation FITC (FAM): Excitation 495 nm/ Emission 520 nm
Application WB
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR
Concentration 0.5 mg/ml
Blocking Peptide For anti-NDUFA13 (ARP75565_P050-FITC) antibody is Catalog # AAP75565
Datasheets/Manuals Printable datasheet for anti-NDUFA13 (ARP75565_P050-FITC) antibody
Target Reference N/A
Gene Symbol NDUFA13
Official Gene Full Name NADH:ubiquinone oxidoreductase subunit A13
Alias Symbols B16.6, CDA016, CGI-39, GRIM19, GRIM-19
NCBI Gene Id 51079
Protein Name NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Description of Target This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
Swissprot Id Q9P0J0
Protein Accession # NP_057049
Protein Size (# AA) 144
Molecular Weight 15kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NDUFA13.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NDUFA13.
Protein Interactions UBC; EXOSC6; XRN1; LIG4; Htt; NDUFB6; SLC25A10; ICT1; UBE3A; STAT3;
  1. What is the species homology for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    This target may also be called "B16.6, CDA016, CGI-39, GRIM19, GRIM-19" in publications.

  5. What is the shipping cost for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NDUFA13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NDUFA13"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NDUFA13"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NDUFA13"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NDUFA13"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NDUFA13"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)
Your Rating
We found other products you might like!