Search Antibody, Protein, and ELISA Kit Solutions

NDUFA13 Antibody - N-terminal region : FITC (ARP75565_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75565_P050 Unconjugated

ARP75565_P050-HRP Conjugated

ARP75565_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Official Gene Full Name:
NADH:ubiquinone oxidoreductase subunit A13
NCBI Gene Id:
Protein Name:
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Swissprot Id:
Protein Accession #:
Alias Symbols:
B16.6, CDA016, CGI-39, GRIM19, GRIM-19
Description of Target:
This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined.
Protein Size (# AA):
Molecular Weight:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NDUFA13.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NDUFA13.
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUAD
Predicted Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: MPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
0.5 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NDUFA13 (ARP75565_P050-FITC) antibody is Catalog # AAP75565
Printable datasheet for anti-NDUFA13 (ARP75565_P050-FITC) antibody
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...