Search Antibody, Protein, and ELISA Kit Solutions

NDP Antibody - middle region (ARP56082_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56082_P050-FITC Conjugated

ARP56082_P050-HRP Conjugated

ARP56082_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NDP
Official Gene Full Name:
Norrie disease (pseudoglioma)
NCBI Gene Id:
4693
Protein Name:
Norrin
Swissprot Id:
Q00604
Protein Accession #:
NP_000257
Nucleotide Accession #:
NM_000266
Alias Symbols:
EVR2, FEVR, ND
Description of Target:
NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c
Protein Size (# AA):
133
Molecular Weight:
15kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NDP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NDP.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human NDP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-NDP (ARP56082_P050)
Peptide Sequence:
Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
FZD4; NDP; BAG3; APP; LGALS8; PPP1CA;
Blocking Peptide:
For anti-NDP (ARP56082_P050) antibody is Catalog # AAP56082 (Previous Catalog # AAPP37547)
Datasheets/Manuals:
Printable datasheet for anti-NDP (ARP56082_P050) antibody
Target Reference:
Khan,A.O., (2008) Ophthalmology 115 (4), 730-733

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...