Size:100 ul
$319.00
In Stock
SKU
ARP56082_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56082_P050-FITC Conjugated

ARP56082_P050-HRP Conjugated

ARP56082_P050-Biotin Conjugated

NDP Antibody - middle region (ARP56082_P050)

Catalog#: ARP56082_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human NDP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-NDP (ARP56082_P050)
Peptide Sequence Synthetic peptide located within the following region: DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-NDP (ARP56082_P050) antibody is Catalog # AAP56082 (Previous Catalog # AAPP37547)
Datasheets/Manuals Printable datasheet for anti-NDP (ARP56082_P050) antibody
Target Reference Khan,A.O., (2008) Ophthalmology 115 (4), 730-733
Gene Symbol NDP
Official Gene Full Name Norrie disease (pseudoglioma)
Alias Symbols EVR2, FEVR, ND
NCBI Gene Id 4693
Protein Name Norrin
Description of Target NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c
Swissprot Id Q00604
Protein Accession # NP_000257
Nucleotide Accession # NM_000266
Protein Size (# AA) 133
Molecular Weight 15kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express NDP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express NDP.
Protein Interactions FZD4; NDP; BAG3; APP; LGALS8; PPP1CA;
  1. What is the species homology for "NDP Antibody - middle region (ARP56082_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "NDP Antibody - middle region (ARP56082_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NDP Antibody - middle region (ARP56082_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NDP Antibody - middle region (ARP56082_P050)"?

    This target may also be called "EVR2, FEVR, ND" in publications.

  5. What is the shipping cost for "NDP Antibody - middle region (ARP56082_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NDP Antibody - middle region (ARP56082_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NDP Antibody - middle region (ARP56082_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NDP Antibody - middle region (ARP56082_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "NDP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NDP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NDP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NDP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NDP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NDP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NDP Antibody - middle region (ARP56082_P050)
Your Rating
We found other products you might like!