NDEL1 Antibody - C-terminal region (ARP78925_P050)

Catalog No: ARP78925_P050

Host: Rabbit
Target Name: NDEL1
Sample Tissue: Human A172 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NDEL1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NDEL1 (ARP78925_P050) antibody is Catalog # AAP78925

Target Info

• Gene Symbol: NDEL1
• Gene Full Name: nudE neurodevelopment protein 1 like 1
• Alias Symbols: EOPA, NDE2, NUDEL, MITAP1, NDE1L1
• NCBI Gene Id: 81565
• Protein Name: nuclear distribution protein nudE-like 1
• Description of Target: Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity).
• Uniprot ID: Q9GZM8
• Protein Accession #: NP_001020750.1
• Nucleotide Accession #: NM_001025579.2
• Protein Size (# AA): 345
• Molecular Weight: 38 kDa