Search Antibody, Protein, and ELISA Kit Solutions

NDEL1 Antibody - C-terminal region (ARP78925_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
nudE neurodevelopment protein 1 like 1
NCBI Gene Id:
Protein Name:
nuclear distribution protein nudE-like 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Positively regulates lysosome peripheral distribution and ruffled border formation in osteoclasts (By similarity).
Protein Size (# AA):
Molecular Weight:
38 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NDEL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NDEL1.
The immunogen is a synthetic peptide directed towards the C terminal region of human NDEL1
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: VLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-NDEL1 (ARP78925_P050) antibody is Catalog # AAP78925
Printable datasheet for anti-NDEL1 (ARP78925_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...