Protein on Demand™ NCU01221 Recombinant Protein (Neurospora crassa) (OPCA327156)

Datasheets/Manuals	Printable datasheet for OPCA327156

Product Info
Predicted Species Reactivity	Neurospora crassa
Product Format	Liquid
Application	WB, ELISA
Additional Information	For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request.
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MSSFESVVVIDGKGHLLGRLASIVAKQLLNGQKIVVVRCEALNISGEFFRAKLKYHSYLRKMTRYNPTRGGPFHFRAPSRIFYKAVRGMIPHKTARGAAALERLKVFEGVPPPYDKKKKMVVPQALRVLRLQPGRKFCTVGRLSSEVGWKYEDVVSRLEERRKAKGAAYYERKKVAARQLSEAKKSAKVNDKTAEALKEFGY
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-202