Search Antibody, Protein, and ELISA Kit Solutions

NCR1 Antibody - C-terminal region (ARP63658_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP63658_P050-FITC Conjugated

ARP63658_P050-HRP Conjugated

ARP63658_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Natural cytotoxicity triggering receptor 1
NCBI Gene Id:
Protein Name:
Natural cytotoxicity triggering receptor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD335, FLJ99094, LY94, NK-p46, NKP46
Replacement Item:
This antibody may replace item sc-18158 from Santa Cruz Biotechnology.
Description of Target:
NCR1 is a cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NCR1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NCR1.
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-NCR1 (ARP63658_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PHF1; CD247; FCER1G; CD59;
Blocking Peptide:
For anti-NCR1 (ARP63658_P050) antibody is Catalog # AAP63658
Printable datasheet for anti-NCR1 (ARP63658_P050) antibody
Sample Type Confirmation:

NCR1 is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...