NCOA2 Antibody - middle region (ARP32770_P050)

Catalog No: ARP32770_P050

Host: Rabbit
Target Name: NCOA2
Sample Type: HT1080 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NCOA2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LLPKSIVNGGSWSGEPPRRNSHTFNCRMLVKPLPDSEEEGHDNQEAHQKY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NCOA2 (ARP32770_P050) antibody is Catalog # AAP32770

Target Info

• Gene Symbol: NCOA2
• Gene Full Name: nuclear receptor coactivator 2
• Alias Symbols: SRC2, TIF2, GRIP1, KAT13C, NCoA-2, bHLHe75
• NCBI Gene Id: 10499
• Protein Name: nuclear receptor coactivator 2
• Description of Target: The NCOA2 gene encodes nuclear receptor coactivator 2, which aids in the function of nuclear hormone receptors. Nuclear hormone receptors are conditional transcription factors that play important roles in various aspects of cell growth, development, and homeostasis by controlling expression of specific genes. Members of the nuclear hormone receptor superfamily, which includes the 5 steroid receptors and class II nuclear receptors (see below), are structurally characterized by 3 distinct domains: an N-terminal transcriptional activation domain, a central DNA-binding domain, and a C-terminal hormone-binding domain. Before the binding of hormone, steroid receptors, which are sometimes called class I of the nuclear hormone receptor family, remain inactive in a complex with heat-shock protein-90 (MIM 140571) and other stress family proteins. Binding of hormone induces critical conformational changes in steroid receptors that cause them to dissociate from the inhibitory complex, bind as homodimers to specific DNA enhancer elements associated with target genes, and modulate that gene's transcription. After binding to enhancer elements, transcription factors require transcriptional coactivator proteins to mediate their stimulation of transcription initiation (Hong et al., 1997 [PubMed 9111344]).[supplied by OMIM, Nov 2010]
• Uniprot ID: Q15596
• Protein Accession #: NP_006531.1
• Nucleotide Accession #: NM_006540.2
• Protein Size (# AA): 370
• Molecular Weight: 40kDa