NCF4 Antibody - C-terminal region (ARP58922_P050)

Catalog No: ARP58922_P050

WB Suggested Anti-NCF4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NCF4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PSLRPLPLTSPSHGSLSHSKAPSGSQMSHNAVTSHQRPGWPGQPHSPFPH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NCF4 (ARP58922_P050) antibody is Catalog # AAP58922 (Previous Catalog # AAPP44869)

Target Info

• Gene Symbol: NCF4
• Gene Full Name: Neutrophil cytosolic factor 4, 40kDa
• Alias Symbols: NCF, CGD3, P40PHOX, SH3PXD4
• NCBI Gene Id: 4689
• Protein Name: Neutrophil cytosol factor 4
• Description of Target: NCF4 is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI(3) kinase, which suggests its role in PI(3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
• Uniprot ID: A8K4F9
• Protein Accession #: NP_038202
• Nucleotide Accession #: NM_013416
• Protein Size (# AA): 348
• Molecular Weight: 39kDa
• Protein Interactions: NCF2; UBC; CORO1A; MSN; CYBB; NCF1; CYBA; TXN; PRKCD; XRCC6; PRKDC;