Catalog No: ARP55484_P050
Price: $0.00
SKU
ARP55484_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-NCAPH2 (ARP55484_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 75%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NCAPH2 (ARP55484_P050) antibody is Catalog # AAP55484 (Previous Catalog # AAPP33376)
Sample Type Confirmation

NCAPH2 is strongly supported by BioGPS gene expression data to be expressed in 721_B

SubunitH2
ReferenceOno,T., (2003) Cell 115 (1), 109-121
Gene SymbolNCAPH2
Gene Full NameNon-SMC condensin II complex, subunit H2
Alias SymbolsCAPH2
NCBI Gene Id29781
Protein NameCondensin-2 complex subunit H2
Description of TargetCondensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM].
Uniprot IDQ6IBW4
Protein Accession #NP_689512
Nucleotide Accession #NM_152299
Protein Size (# AA)605
Molecular Weight68kDa
Protein InteractionsEGLN3; USHBP1; SNRPC; UBC; EGFR; LMO2; FOLR1; NCAPG2; NCAPD3; SMC2; SMC4;
  1. What is the species homology for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Rabbit".

  2. How long will it take to receive "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NCAPH2 Antibody - N-terminal region (ARP55484_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    This target may also be called "CAPH2" in publications.

  5. What is the shipping cost for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "68kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NCAPH2 Antibody - N-terminal region (ARP55484_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NCAPH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NCAPH2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NCAPH2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NCAPH2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NCAPH2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NCAPH2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NCAPH2 Antibody - N-terminal region (ARP55484_P050)
Your Rating
We found other products you might like!