Search Antibody, Protein, and ELISA Kit Solutions

NBPF3 Antibody - N-terminal region : FITC (ARP72278_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP72278_P050 Unconjugated

ARP72278_P050-HRP Conjugated

ARP72278_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NBPF3
NCBI Gene Id:
84224
Swissprot Id:
Q9H094-4
Alias Symbols:
NBPF3, L7,
Description of Target:
This gene is a member of the neuroblastoma breakpoint family (NBPF) which consists of dozens of recently duplicated genes primarily located in segmental duplications on human chromosome 1. This gene family has experienced its greatest expansion within the human lineage and has expanded, to a lesser extent, among primates in general. Members of this gene family are characterized by tandemly repeated copies of DUF1220 protein domains. DUF1220 copy number variations in human chromosomal region 1q21.1, where most DUF1220 domains are located, have been implicated in a number of developmental and neurogenetic diseases such as microcephaly, macrocephaly, autism, schizophrenia, mental retardation, congenital heart disease, neuroblastoma, and congenital kidney and urinary tract anomalies. Altered expression of some gene family members is associated with several types of cancer. This gene family contains numerous pseudogenes.
Protein Size (# AA):
275
Molecular Weight:
30kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NBPF3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NBPF3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NBPF3
Predicted Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Peptide Sequence:
Synthetic peptide located within the following region: CDQVKKEDQEATSPRLSRELLDEKEPEVLQDSLDRFYSTPFEYLELPDLC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
NBPF3; APP; UBD; UBC; TSEN15; ANK1; EWSR1;
Blocking Peptide:
For anti-NBPF3 (ARP72278_P050-FITC) antibody is Catalog # AAP72278
Datasheets/Manuals:
Printable datasheet for anti-NBPF3 (ARP72278_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...