Search Antibody, Protein, and ELISA Kit Solutions

NBN Antibody - middle region : FITC (ARP30384_T100-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP30384_T100 Unconjugated

ARP30384_T100-HRP Conjugated

ARP30384_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NBN
NCBI Gene Id:
4683
Swissprot Id:
O60934
Description of Target:
Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.
Protein Size (# AA):
754
Molecular Weight:
85kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NBN.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NBN.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of Human NBN
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: TGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSER
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
ATRX; RPA3; RPA2; RPA1; EP300; CBX8; UBE2N; UBE2D1; UBC; NCL; H2AFX; RNF8; MDC1; TERF2; MRE11A; TERF2IP; RAD50; TLK1; DCLRE1C; RBBP8; BRCA1; MDM2; CCNE1; SKP2; ATM; ATRIP; XRCC5; PRKDC; LIG3; IPO5; HSPA4; ATR; UBE2A; BARD1; BACH1; RAD18; CD3EAP; UBE2B; WR
Blocking Peptide:
For anti-NBN (ARP30384_T100-FITC) antibody is Catalog # AAP30384
Datasheets/Manuals:
Printable datasheet for anti-NBN (ARP30384_T100-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...